Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens cyclin dependent kinase inhibitor 2B (CDKN2B), transcript variant 2 (NM_078487). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P42772 |
| Entry Name | CDN2B_HUMAN |
| Gene Names | CDKN2B MTS2 |
| Alternative Gene Names | MTS2 |
| Alternative Protein Names | Cyclin-dependent kinase 4 inhibitor B (Multiple tumor suppressor 2) (MTS-2) (p14-INK4b) (p15-INK4b) (p15INK4B) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 138 |
| Molecular Weight(Da) | 14722 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD |
Background
| Function | FUNCTION: Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest. |
| Pathway | |
| Protein Families | CDKN2 cyclin-dependent kinase inhibitor family |
| Tissue Specificity | Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines. {ECO:0000269|PubMed:9230210}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |